PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_011970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 140aa    MW: 15783.2 Da    PI: 7.5033
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_011970genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260108.93.8e-34121111100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C ++C+la yfpa++++++   h++FG+ n++k++k+++e+er++a+++lv eA++r+++Pv+G++ + + lq q++++ +el+++k
  DCAR_011970  12 SCAACKYLRRRCDQSCFLAHYFPASKSQDYLSCHRVFGTYNLVKMIKSVQEHERHEAVATLVLEARMRVSNPVHGCLMMQRVLQAQIDEHLEELDAVK 109
                  6**********************************************************************************************999 PP

       DUF260  99 ee 100
                  ++
  DCAR_011970 110 KK 111
                  86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.23411112IPR004883Lateral organ boundaries, LOB
PfamPF031956.4E-3312109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MKGTTAANTA SSCAACKYLR RRCDQSCFLA HYFPASKSQD YLSCHRVFGT YNLVKMIKSV  60
QEHERHEAVA TLVLEARMRV SNPVHGCLMM QRVLQAQIDE HLEELDAVKK KVFLFESLHS  120
QIELLDDQLI NTSLAVVPE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28661752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.12e-24LOB domain-containing protein 23